DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc14A and Fcgbpl1

DIOPT Version :9

Sequence 1:NP_727928.3 Gene:Muc14A / 318097 FlyBaseID:FBgn0052580 Length:16223 Species:Drosophila melanogaster
Sequence 2:NP_001158128.1 Gene:Fcgbpl1 / 292746 RGDID:1311906 Length:2581 Species:Rattus norvegicus


Alignment Length:406 Identity:88/406 - (21%)
Similarity:137/406 - (33%) Gaps:131/406 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   529 NTKTD--QFDTEEETSLSEFLPEW-PTVLGSSLQ---------------FSTIETQPSTNN--GQ 573
            |.|.|  :.|..:..|..|....| .||.|||..               :.|:|.:.|.|.  |.
  Rat   978 NPKNDFQKSDGSQAVSPGELGKSWEKTVPGSSCTPRPACKPGQDCTPKCYPTLERKYSGNEFCGL 1042

  Fly   574 LTHTEKTTLSKSINHIKHHKINLGQN---------AEAASHFNIQPGALH----TISTTGGYHPT 625
            ||:......:       .||:...|.         .....:.:|...::|    .....||   |
  Rat  1043 LTNPTGPLAA-------CHKLLDPQGPLQNCVFDLCLGGGNLSILCNSIHAYVSACQEAGG---T 1097

  Fly   626 VKKKQSETL-PLLSTKSISLNMCDCTCKLEIAKDS----CI------CECNLKKSTSDISKGVTA 679
            ||..:::|. |:..:......:|..||.|:.:..:    |:      |||:     :|..:.:||
  Rat  1098 VKPWRNQTFCPMECSPHSHYEVCADTCSLDCSTITTPIKCLKTCSEGCECD-----TDFLQSITA 1157

  Fly   680 SASNQSLPTETNRKLHSMKDYAPNGTSLLTNASP----EPFTIDDVTYKGNLAGKKTTMPSELSS 740
                 .:|.|.....|:...|.|..:.|:.|...    .|.|       |.:....:..|.|:  
  Rat  1158 -----CVPMEKCGCHHNGVYYEPEESVLIENCQQHCVCHPGT-------GMVCQDHSCKPGEV-- 1208

  Fly   741 LKKIEPVKT---HDVCE---C----TCLLEQGNDSCTCN----CM--------------TDFIST 777
            .|....|.|   .|.|:   |    ||....|...||.|    |.              |:|..|
  Rat  1209 CKPSRGVLTCINKDPCKGVTCRSQETCTERDGKGVCTANYESKCWVWGDPHYHSFDGLNTNFHGT 1273

  Fly   778 -SIQISSTGPDQISQNKMGNQSQSVPLLNTEFSDLMKISTTYKMHQTQNDIEKLSKSPPVLSTTS 841
             |.|::.||...||...:           |.|:.:.|       |::|:       :|.|.:...
  Rat  1274 CSYQLAGTGCPGISAEGL-----------TPFNVVTK-------HESQS-------NPTVSNVKK 1313

  Fly   842 SGLPKWPTTRTLEKKK 857
            ..:..:.|:.|:.|||
  Rat  1314 VTVTTYNTSITIHKKK 1329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc14ANP_727928.3 PRK14949 <11377..11776 CDD:237863
PRK08581 11922..>12215 CDD:236304
PRK14949 <13679..14114 CDD:237863
PRK14949 <14663..15055 CDD:237863
Fcgbpl1NP_001158128.1 VWD 56..212 CDD:278521
C8 252..326 CDD:214843
TIL 329..383 CDD:280072
VWD 448..598 CDD:278521
C8 644..714 CDD:285899
TIL 718..771 CDD:280072
VWC 773..827 CDD:302663
VWD 831..988 CDD:214566 3/9 (33%)
C8 1033..1108 CDD:214843 16/84 (19%)
TIL 1111..1164 CDD:280072 13/62 (21%)
VWC 1166..1218 CDD:302663 12/60 (20%)
VWD 1252..1411 CDD:278521 22/103 (21%)
C8 1450..1525 CDD:214843
TIL 1529..1583 CDD:280072
VWD 1651..1807 CDD:278521
C8 1838..1913 CDD:214843
TIL 1916..1969 CDD:280072
VWC 1974..2025 CDD:302663
VWD 2037..2178 CDD:214566
C8 2220..2294 CDD:214843
TIL 2297..2350 CDD:280072
VWC 2355..2404 CDD:302663
VWD 2404..2558 CDD:295339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.