DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc14A and Ndp

DIOPT Version :9

Sequence 1:NP_727928.3 Gene:Muc14A / 318097 FlyBaseID:FBgn0052580 Length:16223 Species:Drosophila melanogaster
Sequence 2:NP_035013.1 Gene:Ndp / 17986 MGIID:102570 Length:131 Species:Mus musculus


Alignment Length:112 Identity:29/112 - (25%)
Similarity:45/112 - (40%) Gaps:23/112 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly 10226 LSTSLSQSSSKTMNIFSSQNVKEDKTFQEDTR-------TQSISFPQSSTKANSLLSVSRAEEQS 10283
            |:.|:|..|  .:.|....:.|.|.:|..|::       ..|||.|.....:..:| ::|.|...
Mouse     6 LAASISMLS--LLAIMGDTDSKTDSSFLMDSQRCMRHHYVDSISHPLYKCSSKMVL-LARCEGHC 67

  Fly 10284 SQFSSLDMIEPITSSKLSTHNDCECTCLLEQGKDSCTCNCMTDTNSI 10330
            ||.|   ..||:.|..         |.|.:..:.||.| |...|:.:
Mouse    68 SQAS---RSEPLVSFS---------TVLKQPFRSSCHC-CRPQTSKL 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc14ANP_727928.3 PRK14949 <11377..11776 CDD:237863
PRK08581 11922..>12215 CDD:236304
PRK14949 <13679..14114 CDD:237863
PRK14949 <14663..15055 CDD:237863
NdpNP_035013.1 CT 41..127 CDD:214482 20/75 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.