powered by:
Protein Alignment CG32579 and CAPN6
DIOPT Version :9
Sequence 1: | NP_001259606.1 |
Gene: | CG32579 / 318096 |
FlyBaseID: | FBgn0052579 |
Length: | 359 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_055104.2 |
Gene: | CAPN6 / 827 |
HGNCID: | 1483 |
Length: | 641 |
Species: | Homo sapiens |
Alignment Length: | 63 |
Identity: | 17/63 - (26%) |
Similarity: | 24/63 - (38%) |
Gaps: | 29/63 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 WSLAYVYWMEESYGYCAWTIGSILVPMVVTSVIYIHTLKSAHAGEKRILERGVYSNAVIS-YL 102
|:||..| |.|||.: |:.||...||: |:|..:: ||
Human 507 WNLARGY------------------PKVVTQI----TVHSAEDLEKK------YANETVNPYL 541
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0045 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.