DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and CAPN1

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001185797.1 Gene:CAPN1 / 823 HGNCID:1476 Length:714 Species:Homo sapiens


Alignment Length:113 Identity:26/113 - (23%)
Similarity:40/113 - (35%) Gaps:42/113 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 GEKRILERGVYSNAVISYL--FRDVYVLNYAFKYSLAKERDDKQAEIEYYQKLMTEECNVSFVRL 146
            |:..::|..:..|.:.:||  ||         |:.|     ||...:..|:..|.          
Human   603 GKLGLVEFNILWNRIRNYLSIFR---------KFDL-----DKSGSMSAYEMRMA---------- 643

  Fly   147 FDSFLESA----PQKILQLAILLQSTLEFTYYRHIALIVYFGNIAWCI 190
                :|||    .:|:.:|.|        |.|....|.|.|.|...|:
Human   644 ----IESAGFKLNKKLYELII--------TRYSEPDLAVDFDNFVCCL 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 26/113 (23%)
CAPN1NP_001185797.1 Peptidase_C2 56..352 CDD:306994
Domain III 355..526
Calpain_III 364..524 CDD:238132
Linker 527..542
Domain IV 543..713 26/113 (23%)
EFh_PEF_CAPN1 546..714 CDD:320073 26/113 (23%)
EF-hand motif 546..574 CDD:320073
EF-hand motif 589..618 CDD:320073 3/14 (21%)
EF-hand motif 619..649 CDD:320073 13/57 (23%)
EF-hand motif 655..683 CDD:320073 9/33 (27%)
EF-hand motif 685..714 CDD:320073
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.