DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and xkr9

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001029117.1 Gene:xkr9 / 619361 XenbaseID:XB-GENE-5841541 Length:367 Species:Xenopus tropicalis


Alignment Length:358 Identity:87/358 - (24%)
Similarity:151/358 - (42%) Gaps:45/358 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SKLSMLLTVVSILWRFVSIC---INWSLAYVYWMEESYGYCAWTIGSILVPMVVTSVI-YIHTLK 79
            ||.:.|:|:..|   |..:|   ::..:|..|:.:..|.:...||..|::...:.:|. |.....
 Frog     4 SKWNFLMTIFGI---FTLVCDYGVDLWIAVKYFQQGLYIFSLLTILFIVISNAIVNVFSYAWIKD 65

  Fly    80 SAHAGEKRILERGVYSNAVISYLFRDVYV-------LNYAFKYSLAKERDDKQAEIEYYQKLMTE 137
            ....|..|.| |.|:   ||..|....::       ..|....|...|.|..:..    :|.:..
 Frog    66 DCTEGNTRKL-RWVW---VIHVLMAGTFLRYWHAVKCGYRAAMSTHSEGDFTKTN----KKAVDA 122

  Fly   138 ECNVSFVRLFDSFLESAPQKILQLAILLQSTLEFTYYRHIALIVYFGNIAWCIQAYNHSNRLAQL 202
            ..::|.:|.|.:||||.||.|||:.||::.. :.|..::..:|:...:|:|....|:.|.|.:..
 Frog   123 MTDLSMLRCFKTFLESTPQLILQIYILMEHG-QITLLQYATIIISVFSISWSTVDYHMSLRSSLE 186

  Fly   203 DKHDIAAKGRFLQFLFLLCLTVIRFYFVVSRTLCIAYVASIFPIETLIICATLACFY--GTIVFF 265
            :|.:|:        |.|..:|.: .|.:::.|..|..:..:......|..|.|...:  |....:
 Frog   187 NKKEIS--------LGLPAVTYV-LYKLLTLTSWILSLVFLLACNVYIFVALLGILWILGLCWAW 242

  Fly   266 VDSPMIAKSRPMNYSYCLCFGVVYLFIFTPVKDAPTKYKYAFYLTFCLLQNI---IACALY---- 323
            ..:.....:..|...|.:...|:.:..|..||...|:...:.|.||.::..|   |.|.|:    
 Frog   243 KQNTEFCTNMRMEILYRIVVAVILVLTFFNVKGQRTRVPMSVYYTFRIVATIGILILCFLFKESL 307

  Fly   324 -IPLYLATAIIALYI---VGIVLLIIYYTYCHP 352
             ..|:.|...|||.:   :|::.||:||...||
 Frog   308 TRKLFFAVFSIALVLALGLGLMSLILYYCLFHP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 84/352 (24%)
xkr9NP_001029117.1 XK-related 10..341 CDD:286853 84/352 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7793
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5204
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.