DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and xkr8

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_012812573.2 Gene:xkr8 / 619360 XenbaseID:XB-GENE-940182 Length:566 Species:Xenopus tropicalis


Alignment Length:273 Identity:66/273 - (24%)
Similarity:117/273 - (42%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 ISYLFRDVYVLNYAFKYSLAKERDDKQAEIEYYQKLMTEECNVSFVRLFDSFLESAPQKILQLAI 163
            :.|..|.::.|........:.|.:......:.|...:|.:  :|.:||.::|||:.||.||.|.|
 Frog   265 LGYPLRCIHSLEVGIAAYRSSENNPTYDRYQEYAYFLTHD--ISMMRLMETFLENTPQLILLLYI 327

  Fly   164 LLQSTLEFTYYRHIALIVYFGNIAWCIQAYNHSNRLAQLDKHDIAAKGRFLQFLFLLCLTVIRFY 228
            :|.....:| :::.::.:.|.:|:|.|..|:.|.||...||..:......:.||:.|.|      
 Frog   328 VLHRGTIYT-FQYFSISISFISISWAILDYHQSLRLFLKDKQSMNILSSIIYFLWNLLL------ 385

  Fly   229 FVVSRTLCIAYVASIFPIETLIICATLACFYGTIVFFV----DSPMIAKSRPMNYSYCLCFGVVY 289
             :.||.:||....|:|.:...:....|     .|.||:    .|....::|.:.:.:.....|:.
 Frog   386 -IFSRIVCITLFISVFHLWVALHFLLL-----WIAFFLWATWQSTDFMRNRILEHFFRATVAVIL 444

  Fly   290 LFIFTPVKDAPTKYKYAFYLTFCLLQNIIACALYI--------------PLYLATAIIALYIVGI 340
            .|.:..:.|..|.|:...|..|....::|   |::              ..||...:...:.|||
 Frog   445 YFSWFNIADGRTIYRCIVYYCFITADSVI---LFMSWKIFKFPSILDEYETYLLYVLAVFFPVGI 506

  Fly   341 VLLIIYYTYCHPN 353
            :..::||.|.|||
 Frog   507 LFRVLYYLYLHPN 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 64/271 (24%)
xkr8XP_012812573.2 XK-related <266..519 CDD:401682 64/270 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7793
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5204
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16024
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.