DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and xkr5

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001029114.1 Gene:xkr5 / 619358 XenbaseID:XB-GENE-5870731 Length:665 Species:Xenopus tropicalis


Alignment Length:341 Identity:74/341 - (21%)
Similarity:146/341 - (42%) Gaps:72/341 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YWMEESYGYCAWTIGSILVPMVVTSVIYIHTLKSAHAGE-----KRILERGVYSNAVISYLFRDV 106
            |::...|.:.:.|:..::...:|.::.:....|...||.     ..:|:.|:        |.|..
 Frog    32 YFLTGQYTWASCTLALLIPGCLVQALSFAWFRKEGPAGGFTVTLIHVLQLGI--------LKRQA 88

  Fly   107 YVLNYAFKYSLAKERDDKQAEIEYYQKLMTEECNVSFVRLFDSFLESAPQKILQLAILLQSTLEF 171
            ..|..|.       |:.|:.:....::|:.::.:.:.:||.::.|::.|..:||..|.|  .||:
 Frog    89 DCLQVAL-------REGKRQKPGNERELLMQQGDAALLRLVEALLQALPHLLLQTYIYL--ALEY 144

  Fly   172 T-YYRHIALIVYFGNIAWCIQAYNHSNRLAQLDKHDIAAKGRFLQFL----------FLLCLTVI 225
            | .|..|:.::...:::|.:.:|:                 |||..|          .|||..:.
 Frog   145 TNAYAGISALLSLLSLSWALVSYS-----------------RFLCLLKPGHLSMPWASLLCQLLW 192

  Fly   226 RFYFVVSRTLCIAYVASIFPIETLIICATLACFYGTIVFFVDSPMIAK-----SRPMNYS-YCLC 284
            |...:.:|.:.:|..|.::   ...:.|.....:..:.|:    ::|:     |||..:. :...
 Frog   193 RMGMIGTRAMALAVFARVY---HFWVFAVAGAHWLVMSFW----LVAQQTDLISRPCYWKLFNAL 250

  Fly   285 FGVVYLFIFTPVKDAPTKYKYAFYLTFCLLQNIIAC---------ALYIPLYLATAIIALYIVGI 340
            .|.||:|.|..|:|.|::|:.|.:.|..||:|.|..         .|:..:.|...::..:::|.
 Frog   251 VGAVYVFCFLNVRDGPSRYRVAIFYTVMLLENAILLLLATDFLQGVLWSNVRLTVVVMCGFLIGC 315

  Fly   341 VLLIIYYTYCHPNTVR 356
            ..||||||..||.:.:
 Frog   316 AALIIYYTLLHPKSTQ 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 73/336 (22%)
xkr5NP_001029114.1 XK-related 10..328 CDD:286853 73/336 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7793
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.