DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and xkr4

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001027478.1 Gene:xkr4 / 613062 XenbaseID:XB-GENE-5813487 Length:617 Species:Xenopus tropicalis


Alignment Length:335 Identity:81/335 - (24%)
Similarity:135/335 - (40%) Gaps:92/335 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SYGYCAWTIGSILVPMVVTSVIYIHTLKSAHAGEKRILERGVYSNAVISYLFRDVYVLNYAFKYS 116
            |..:|.|.:.|:           ||           ||:.|     .|...|..:|:       .
 Frog   214 SCSFCIWIMQSL-----------IH-----------ILQLG-----QIWRYFHTIYL-------G 244

  Fly   117 LAKERDDKQAEIEYYQKLMTEECNVSFVRLFDSFLESAPQKILQLAILLQSTLEFTYYRHIALIV 181
            :...|..:.....:|.|::.|..:||.:.|..:|||||||.:|||.|::| |......:.:....
 Frog   245 IRSRRSGENDRWRFYWKMVYEYADVSMLHLLATFLESAPQLVLQLCIVVQ-TRSLQALQGLTAAA 308

  Fly   182 YFGNIAWCIQAYNHSNRLAQLDKHDIAAKGRFLQFLFLLCLTVIRFYFVVSRTLCIAYVASIFPI 246
            ...::||.:.:|..:.|.::.||..|:.....:||.:       .|:.:.:|.:..|..||:|.:
 Frog   309 SLVSLAWALASYQKALRDSRDDKKPISYMAVIIQFCW-------HFFTIAARVITFALFASVFQL 366

  Fly   247 E--------------TLIICATLACF--YGTIVFFVDSPMIAKSRPMNYSYCLCFGVVYLFIFTP 295
            .              .::.|.|..|.  :..|||    .|:.             |::|:|.:..
 Frog   367 YFGIFIVLHWCIMTFWIVHCETEFCITKWEEIVF----DMVV-------------GIIYIFSWFN 414

  Fly   296 VKDAPTKYKYAFYLTFCLLQNIIACALYIPLYL--------ATAIIAL------YIVGIVLLIIY 346
            ||:..|:.:...|....||:|.....|:   ||        |.||.||      ::.|||.:::|
 Frog   415 VKEGRTRCRLFIYYFVILLENTALSTLW---YLNKAPQILDAFAIPALCVVFSSFLTGIVFMLMY 476

  Fly   347 YTYCHPNTVR 356
            |.:.|||..|
 Frog   477 YAFFHPNGPR 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 78/330 (24%)
xkr4NP_001027478.1 XK-related 98..483 CDD:286853 78/330 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7793
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230316at2759
OrthoFinder 1 1.000 - - FOG0001048
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16024
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.