DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and si:ch211-202f3.3

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_017207337.2 Gene:si:ch211-202f3.3 / 553353 ZFINID:ZDB-GENE-080917-19 Length:846 Species:Danio rerio


Alignment Length:158 Identity:38/158 - (24%)
Similarity:61/158 - (38%) Gaps:50/158 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WRF-----VSI-----CINWSLAYV-------YW---MEESY-----GYCAWTIGSILVPMV-VT 70
            |||     |.|     .||..|.:|       :|   :|::|     .|.....|.:...:: .|
Zfish   295 WRFGKWFDVVIDDKLPTINRQLIFVKSKTYNEFWPALLEKAYAKVCGSYADMHTGRVSEALLDFT 359

  Fly    71 SVIYIH-TLKSA---------HAGEKRILERGVYSNAVISYLFRDVYVLNYAFKYSLAKERDDKQ 125
            ..:::| .||:|         .|.:..:| .|..|.|.......:..||.:|  |::.|      
Zfish   360 GGVHMHYDLKTAPTDLWEIMYRASQSEVL-MGCESPAGNEERLPNGIVLGHA--YTVTK------ 415

  Fly   126 AEIEYYQKLMTEECNVSFVRLFDSFLES 153
                .|| :|:....|..||||:.:.:|
Zfish   416 ----VYQ-VMSGRNPVQLVRLFNPWGDS 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 38/158 (24%)
si:ch211-202f3.3XP_017207337.2 Peptidase_C2 198..487 CDD:306994 38/158 (24%)
Calpain_III 509..647 CDD:307285
EFh_PEF_CAPN13_14 683..846 CDD:320070
EF-hand motif 683..709 CDD:320070
EF-hand motif 723..752 CDD:320070
EF-hand motif 753..783 CDD:320070
EF-hand motif 789..817 CDD:320070
EF-hand motif 819..846 CDD:320070
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.