DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and XKR8

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_011539981.1 Gene:XKR8 / 55113 HGNCID:25508 Length:449 Species:Homo sapiens


Alignment Length:284 Identity:53/284 - (18%)
Similarity:100/284 - (35%) Gaps:71/284 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 YSLAKERDDKQAEIEYYQKLMTEECN---------VSFVRL------------------FDSFLE 152
            :|..:|..||:.:.....:|.||..:         |:..|:                  |...||
Human   141 FSTLEEPRDKEIDNYCVMRLQTEARSGFWAPNRFPVNICRMTAVDGDRGGSSRETCRCHFHPSLE 205

  Fly   153 SAPQKILQLAILLQSTLEFTYYRHIALIVYFGNIAWCIQAYNHSNRLAQLDKHDIAAKGRFLQFL 217
            :       |.:|||....    ..:.:...|..|:|.:..|:.:.|.....|..:......:.||
Human   206 A-------LVLLLQDWQP----GGVGICTSFLGISWALLDYHRALRTCLPSKPLLGLGSSVIYFL 259

  Fly   218 FLLCLTVIRFYFVVSRTLCIAYVASIFP-------IETLIICATLACFYGTIVFFVDSPMIAKSR 275
            :.|.|       :..|.|.:|..:::||       :...::........||  .|:..|      
Human   260 WNLLL-------LWPRVLAVALFSALFPSYVALHFLGLWLVLLLWVWLQGT--DFMPDP------ 309

  Fly   276 PMNYSYCLCFGVVYLFIFTPVKDAPTKYKYAFYLTFCLLQNIIACALY----------IPLYLAT 330
            ...:.|.:....:..|.:..|.:..|:.:...:..|.|..:|:..|.:          |||.|..
Human   310 SSEWLYRVTVATILYFSWFNVAEGRTRGRAIIHFAFLLSDSILLVATWVTHSSWLPSGIPLQLWL 374

  Fly   331 AI-IALYIVGIVLLIIYYTYCHPN 353
            .: ...:.:|:.|.::||.:.||:
Human   375 PVGCGCFFLGLALRLVYYHWLHPS 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 52/282 (18%)
XKR8XP_011539981.1 XK-related <218..398 CDD:286853 36/194 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8229
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5370
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16024
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.