DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and Xkr5

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_038950670.1 Gene:Xkr5 / 497083 RGDID:1359335 Length:675 Species:Rattus norvegicus


Alignment Length:361 Identity:72/361 - (19%)
Similarity:152/361 - (42%) Gaps:73/361 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LSMLLTVVSILWRFVSICINWSLAYVYWMEESYGYCAWTIGSILVP-MVVTSVIYIHTLKSAHAG 84
            ||.||.......|..||...::...::|        .|...|:|:| .:|.::.::......|.|
  Rat     8 LSALLQAAEQSARLCSIVYYFATGRLFW--------GWLALSVLLPGFLVQALSFLWFQADGHQG 64

  Fly    85 E-----KRILERGVYS---NAVISYLFRDVYVLNYAFKYSLAKERDDKQAEIEYYQKLMTEECNV 141
            .     ..:|:.||:.   ::|...|:                    |..|...:.:|..:|.::
  Rat    65 PWWLAVLHLLQLGVWKRHWDSVAMALW--------------------KGKEAPSWGQLHLQEADL 109

  Fly   142 SFVRLFDSFLESAPQKILQLAILLQSTLEFT-YYRHIALIVYFGNIAWCIQAYNHSNRLAQLDK- 204
            |.:||.::.|::.|..:||:.:.|.|  :|| ....|:.::.:.:::|.:.:|   ||...:.| 
  Rat   110 SALRLLEALLQTGPHLLLQVYVFLAS--DFTDVVPGISALLSWSSLSWALVSY---NRFLGIMKP 169

  Fly   205 -HDIAAKGRFLQFLFLLCLTVIRFYFVVSRTLCIAYVASIFPIETLIICATLACFYGTIVFFVDS 268
             |      |.:.:..|||..:.|...:.:|.|.:.....::.:..|::.   ...:..:.|:   
  Rat   170 GH------RTMLWAALLCQQLWRMGMLGARVLTLVLFCRVYRVWVLVVG---GAHWLVMTFW--- 222

  Fly   269 PMIAKSRPMNYSYC------LCFGVVYLFIFTPVKDAPTKYKYAFYLTFCLLQNIIACAL----- 322
             ::|:...:..|.|      |..|.|::..:....|:|::.:.|.:....||:|.|...|     
  Rat   223 -LVAQQSDIVESTCHWRLFNLLVGAVFILCYINFWDSPSRSRMASFYLVMLLENSILLLLATDFL 286

  Fly   323 ----YIPLYLATAIIALYIVGIVLLIIYYTYCHPNT 354
                :..|:....:::.:::|...|::||:..||.:
  Rat   287 QGAPWTSLWTVVGVLSGFLIGCASLVVYYSLLHPKS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 68/354 (19%)
Xkr5XP_038950670.1 XK-related 16..321 CDD:401682 67/350 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.