DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and xkr7

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001012253.2 Gene:xkr7 / 497073 ZFINID:ZDB-GENE-051113-336 Length:404 Species:Danio rerio


Alignment Length:246 Identity:61/246 - (24%)
Similarity:113/246 - (45%) Gaps:42/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 YYQKLMTEECNVSFVRLFDSFLESAPQKILQLAILLQSTLEFTYYRHI---------ALIVYFGN 185
            :|.:||.|..:::.:||.::||:||||.:|||:|::.|       .||         |.:|   :
Zfish    35 FYWRLMFESADINMLRLLEAFLKSAPQLVLQLSIMIHS-------NHILPLQGLSASASLV---S 89

  Fly   186 IAWCIQAYNHSNRLAQLDKHDIAAKGRFLQFLFLLCLTVIRFYFVVSRTLCIAYVASIFPIETLI 250
            :||.|.:|....|.::.||..::.|...:|.|:.|       :.:.:||:..|..||:|.:...|
Zfish    90 LAWMIASYQKVPRDSRDDKLPMSYKAVIVQMLWHL-------FTIGARTIAFALFASVFQLYFGI 147

  Fly   251 ICATLACFYGTIVFFV--DSPMIAKSRPMNYSYCLCFGVVYLFIFTPVKDAPTKYKYAFYLTFCL 313
            ......|   .:.|::  .......|:.....|.:..|::|:|.:..||:...:::...|....|
Zfish   148 FIVAHWC---AMTFWIIQGETDFCMSKWEEIIYNMVVGIIYIFCWFNVKEGRARFRLGVYYCVTL 209

  Fly   314 LQNI-IACALYI----------PLYLATAIIALYIVGIVLLIIYYTYCHPN 353
            .:|: :..|.||          .|.:...::..|.:|...:.:||...||:
Zfish   210 FENVALTAAWYIHRGPHTSDFYALIIVCVVVCSYALGTFFMFVYYCLLHPD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 60/244 (25%)
xkr7NP_001012253.2 XK-related <12..259 CDD:286853 59/243 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I6998
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I4990
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230316at2759
OrthoFinder 1 1.000 - - FOG0001048
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16024
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5206
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
99.060

Return to query results.
Submit another query.