DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32579 and sol

DIOPT Version :9

Sequence 1:	NP_001259606.1	Gene:	CG32579 / 318096	FlyBaseID:	FBgn0052579	Length:	359	Species:	Drosophila melanogaster
Sequence 2:	NP_476738.3	Gene:	sol / 44014	FlyBaseID:	FBgn0003464	Length:	1594	Species:	Drosophila melanogaster

Alignment Length:	132	Identity:	28/132 - (21%)
Similarity:	43/132 - (32%)	Gaps:	48/132 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly    95 SNAVISYLFRDVYVLNYAFKYSLAKERDDKQAEIEYYQKLMTEECNVSFVRLFDSFLESAPQKIL 159
            |..|....|.|  ||||.....:.|.|.... |:. .|..:...|::|.|
  Fly  1297 SEGVFWISFED--VLNYFDCIDICKVRSGWN-EVR-LQGTLQPLCSISCV--------------- 1342

  Fly   160 QLAILLQSTLEFTYYRHIALIVYFGNIAWCIQAYNHSNRLAQLDKHDIAAKGRFLQFLFLLCLTV 224
            .|.:|..:..|||.::.       |      |..:..::.:|||                ||:.:
  Fly  1343 LLTVLEPTEAEFTLFQE-------G------QRNSEKSQRSQLD----------------LCVVI 1378

  Fly   225 IR 226
            .|
  Fly  1379 FR 1380

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32579	NP_001259606.1	XK-related	25..353	CDD:286853	28/132 (21%)
sol	NP_476738.3	zf-RanBP	6..34	CDD:279035
		RanBP2-type Zn finger	10..29	CDD:275376
		zf-RanBP	135..164	CDD:279035
		zf-RanBP	643..672	CDD:279035
		RanBP2-type Zn finger	647..667	CDD:275375
		zf-RanBP	704..731	CDD:279035
		RanBP2-type Zn finger	708..727	CDD:275376
		zf-RanBP	747..774	CDD:279035
		RanBP2-type Zn finger	749..768	CDD:275376
		zf-RanBP	927..954	CDD:279035
		RanBP2-type Zn finger	931..950	CDD:275376
		CysPc	1001..1328	CDD:128526	11/33 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0045
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900