DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and Capn11

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001002806.2 Gene:Capn11 / 408218 RGDID:1302946 Length:715 Species:Rattus norvegicus


Alignment Length:167 Identity:30/167 - (17%)
Similarity:63/167 - (37%) Gaps:36/167 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 WMEESYGYCAWTIGSIL--VPMVVTSVIYIHTLKSAHAGEKRILERGVYSNAVISYLFRDVYVLN 110
            |.....|....|||.::  ||....::..||..|....         .|.:...|.:|.:...:|
  Rat   430 WRHAREGPQLLTIGFVVFSVPKEFQNLQDIHLKKDFFM---------KYRDHGFSEIFTNTREVN 485

  Fly   111 YAFK-----YSLAKERDDKQAEIEYYQKLMTEECNVSFVRLFDSFLESAPQKILQLAILLQSTLE 170
            ...:     |.:.....:...:.::..::.||:.:.:::....:.||...::.:..|.|.|:::|
  Rat   486 SHLRLPPGEYVIIPSTFEPHKDADFLLRVFTEKHSETWLLDEVNMLEQLQEETITDADLDQNSVE 550

  Fly   171 FTYYRHIALIVYFGNIAWCIQAYNHSNRLAQLDKHDI 207
            .           |..:|         ||.:|:|.:|:
  Rat   551 L-----------FETLA---------NRDSQVDMYDL 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 30/167 (18%)
Capn11NP_001002806.2 Peptidase_C2 56..352 CDD:279042
Calpain_III 367..520 CDD:279416 17/98 (17%)
Linker. /evidence=ECO:0000250|UniProtKB:Q9UMQ6 528..543 2/14 (14%)
Domain IV. /evidence=ECO:0000250|UniProtKB:Q9UMQ6 544..714 10/44 (23%)
EFh 591..641 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.