DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and CAPN8

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001137434.1 Gene:CAPN8 / 388743 HGNCID:1485 Length:703 Species:Homo sapiens


Alignment Length:160 Identity:33/160 - (20%)
Similarity:53/160 - (33%) Gaps:61/160 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VLNYAFKYSLAKERDDKQAEIEYYQKLMTEECNVSFVRLFDSFLES------APQKILQLAILLQ 166
            :||.||         .|:.:|::      :..|::..|...|.|:|      ...:...|.:.:|
Human   559 LLNEAF---------SKRTDIKF------DGFNINTCREMISLLDSNGTGTLGAVEFKTLWLKIQ 608

  Fly   167 STLEFTYYRHIALIVYFGNIAWCIQAYNHSNRLAQLDKHDIAAKGRFLQFLFLLCLTVIRFYFVV 231
            ..||               |.|... ||||   ..:|.|::....|...|         .....|
Human   609 KYLE---------------IYWETD-YNHS---GTIDAHEMRTALRKAGF---------TLNSQV 645

  Fly   232 SRTLCIAY------------VASIFPIETL 249
            .:|:.:.|            ||.:..:|||
Human   646 QQTIALRYACSKLGINFDSFVACMIRLETL 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 33/160 (21%)
CAPN8NP_001137434.1 Peptidase_C2 46..342 CDD:279042
Calpain_III 356..509 CDD:279416
Domain III 356..379
EFh 580..635 CDD:238008 16/73 (22%)
PTZ00183 618..>692 CDD:185503 16/71 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.