DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and CG18635

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_611267.1 Gene:CG18635 / 37031 FlyBaseID:FBgn0034279 Length:649 Species:Drosophila melanogaster


Alignment Length:195 Identity:38/195 - (19%)
Similarity:80/195 - (41%) Gaps:22/195 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TVVSILWRFVSICINWSLAYVYWMEESYGYCAWTIGSILVPMVVTSVIYIHTLKSAHAGEKRILE 90
            |.:.:|...|....:.:|:|.::.::.....|.|:..:::|.|:|   :|....|....|....|
  Fly    34 TCLGLLVYIVQTASDLALSYQHFRQKEPTLGAGTLVLVILPPVIT---FILVAASKEQRECACSE 95

  Fly    91 RGVYSNAVIS--------YLFRDVYVLNYAFKYSLAKE---RDDKQAEIEYYQKLMTEECNVSFV 144
            |    |..::        :||....:..:..:...|.|   .||...|........|:..|:..:
  Fly    96 R----NKCVALGIGLLKLFLFPFFVIFRFCTRLFWAIEGLFHDDDDVERMKCLAKATQTSNIELL 156

  Fly   145 RLFDSFLESAPQKILQLAILLQSTL----EFTYYRHIALIVYFGNIAWCIQAYNHSNRLAQLDKH 205
            ....::.::|||.||||..:|...:    |.:..:.::|:....::|....:|:......::.:|
  Fly   157 LFVQAYAQAAPQIILQLYHMLVQDMFRNYETSAVQSLSLVFSAIDLAAITTSYHRIESQRRVGRH 221

  Fly   206  205
              Fly   222  221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 38/195 (19%)
CG18635NP_611267.1 XK-related 34..>211 CDD:286853 37/183 (20%)
XK-related <483..624 CDD:286853
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR16024
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5206
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.