DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and XKR7

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001011718.1 Gene:XKR7 / 343702 HGNCID:23062 Length:579 Species:Homo sapiens


Alignment Length:378 Identity:75/378 - (19%)
Similarity:144/378 - (38%) Gaps:76/378 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 WSLAYVYWMEESYGYCAWTIGSILVPMVVTSV------IYIHTLKSAHAGEKRILERGVYSNAVI 99
            | ||..|:::..:.|.:.|:..:|:|.:|..:      :|.::..:...|.....:..|...|.|
Human    76 W-LAASYYLQNQHTYFSLTLLFVLLPSLVVQLLSFRWFVYDYSEPAGSPGPAVSTKDSVAGGAAI 139

  Fly   100 S---------------------------------------------YLFRDVYVLNY--AFKYSL 117
            |                                             :|.:...|..|  |....|
Human   140 STKDSAGAFRTKEGSPEPGPQPAPSSASAYRRRCCRLCIWLLQTLVHLLQLGQVWRYLRALYLGL 204

  Fly   118 AKERDDKQAEIEYYQKLMTEECNVSFVRLFDSFLESAPQKILQLAILLQSTLEFTYYRHIALIVY 182
            ......::....:|.:::.|..:||.:||.::||.||||.:|||::|:...........::....
Human   205 QSRWRGERLRRHFYWQMLFESADVSMLRLLETFLRSAPQLVLQLSLLVHRGGAPDLLPALSTSAS 269

  Fly   183 FGNIAWCIQAYNHSNRLAQLDKHDIAAKGRFLQFLFLLCLTVIRFYFVVSRTLCIAYVASIFPIE 247
            ..::||.:.:|....|.::.||..::.||...|.|:.|       :.:.:|.|..|..||::.:.
Human   270 LVSLAWTLASYQKVLRDSRDDKRPLSYKGAVAQVLWHL-------FSIAARGLAFALFASVYKLY 327

  Fly   248 TLIICATLACFYGTIVFFV--DSPMIAKSRPMNYSYCLCFGVVYLFIFTPVKDAPTKYKYAFYLT 310
            ..|......|   .:.|:|  .......|:.....|.:..|::|:|.:..||:..::.:...|..
Human   328 FGIFIVAHWC---VMTFWVIQGETDFCMSKWEEIIYNMVVGIIYIFCWFNVKEGRSRRRMTLYHC 389

  Fly   311 FCLLQNIIACAL----------YIPLYLATAIIALYIVGIVLLIIYYTYCHPN 353
            ..||:|......          :..|.:...:.:.:.:||..:.:||...|||
Human   390 IVLLENAALTGFWYSSRNFSTDFYSLIMVCVVASSFALGIFFMCVYYCLLHPN 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 73/376 (19%)
XKR7NP_001011718.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
XK-related 59..442 CDD:286853 73/376 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..166 0/19 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 466..510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8229
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230316at2759
OrthoFinder 1 1.000 - - FOG0001048
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16024
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5206
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.050

Return to query results.
Submit another query.