DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and CalpC

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster


Alignment Length:107 Identity:21/107 - (19%)
Similarity:37/107 - (34%) Gaps:32/107 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 INWSLAYVYWMEESYGYCAWTIGSILVPMVVTSVIYIHTLKSAHAGEKRILERGVYSNAVISYL- 102
            ||..||:   |:.....|.|      ..::..::..:|       |....|:.|..|:.:...| 
  Fly   139 INGRLAF---MQPQASNCFW------AALLEKAIAKLH-------GSYEALKYGTRSDGLTDLLG 187

  Fly   103 --FRDVYVLNYAFKYSLAKERDDKQAEIEYYQKLMTEECNVS 142
              .|.:.:|:...:....||             |:|..|.|:
  Fly   188 GVVRQMPILSDNIRPQTLKE-------------LLTTTCIVT 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 21/107 (20%)
CalpCNP_573118.2 CysPc 7..329 CDD:238004 21/107 (20%)
Calpain_III 346..483 CDD:238132
FRQ1 <567..648 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.