DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and Capn7

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001025208.1 Gene:Capn7 / 306260 RGDID:1304855 Length:813 Species:Rattus norvegicus


Alignment Length:112 Identity:25/112 - (22%)
Similarity:47/112 - (41%) Gaps:30/112 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SVIYIHTLKSAHAGEKRILERGVYSNAVISYLFRDVYVLNYAF----------KYSLAKER---- 121
            ::||   .:.|.:..:||.|:      :..||.| |..|:.|.          |:.|..||    
  Rat    39 ALIY---AEMAGSSLERIQEK------ISEYLER-VQALHSAVQSKSTDPLKSKHQLDLERAHFL 93

  Fly   122 ------DDKQAEIEYYQKLMTEECNVSFVRLFDSFLESAPQKILQLA 162
                  :|::..:|...:|.||..::.....:::..::...|:.|||
  Rat    94 VTQAFDEDEKGNVEDAIELYTEAVDLCLKTSYETADKTLQNKLKQLA 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 25/112 (22%)
Capn7NP_001025208.1 MIT_calpain7_1 5..76 CDD:239144 12/46 (26%)
MIT 85..157 CDD:412291 12/56 (21%)
CysPc 214..538 CDD:238004
calpain_III 687..810 CDD:214786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.