DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32579 and Capn15

DIOPT Version :9

Sequence 1:	NP_001259606.1	Gene:	CG32579 / 318096	FlyBaseID:	FBgn0052579	Length:	359	Species:	Drosophila melanogaster
Sequence 2:	XP_008765793.1	Gene:	Capn15 / 303000	RGDID:	1306514	Length:	1193	Species:	Rattus norvegicus

Alignment Length:	107	Identity:	22/107 - (20%)
Similarity:	32/107 - (29%)	Gaps:	49/107 - (45%)

- Green bases have known domain annotations that are detailed below.

  Fly   143 FVRLFDSF--------------------LESAPQKILQLAILLQSTLEFTYYRHIALIVYFGNIA 187
            |:|.|||.                    ..|.|..:..|.:|.:::|||..::
  Rat   853 FIRYFDSVDICKVHSDWQEARVQGCFPSTASGPVGVTALTVLERASLEFALFQ------------ 905

  Fly   188 WCIQAYNHSNRLAQLDKHDIAAKGRFLQFLFLLCLTVIRFYF 229
                  ..|.|...:|.|           |..||:.|.|..|
  Rat   906 ------EGSRRSDSVDSH-----------LLDLCILVFRATF 930

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32579	NP_001259606.1	XK-related	25..353	CDD:286853	22/107 (21%)
Capn15	XP_008765793.1	ZnF_RBZ	71..95	CDD:197784
		RanBP2-type Zn finger	73..92	CDD:275376
		ZnF_RBZ	113..135	CDD:197784
		RanBP2-type Zn finger	114..133	CDD:275376
		PHA03247	<137..380	CDD:223021
		ZnF_RBZ	211..233	CDD:197784
		RanBP2-type Zn finger	211..230	CDD:275376
		ZnF_RBZ	412..434	CDD:197784
		RanBP2-type Zn finger	412..431	CDD:275376
		RanBP2-type Zn finger	449..464	CDD:275375
		ZnF_RBZ	482..506	CDD:197784
		RanBP2-type Zn finger	484..503	CDD:275376
		CysPc	544..864	CDD:238004	5/10 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0045
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900