DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and Xkr4

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001011971.2 Gene:Xkr4 / 297801 RGDID:1549780 Length:647 Species:Rattus norvegicus


Alignment Length:338 Identity:80/338 - (23%)
Similarity:139/338 - (41%) Gaps:98/338 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SYGYCAWTIGSILVPMVVTSV-IYIHTLKSAHAGEKRILERGVYSNAVISYLFRDVYVLNYAFKY 115
            |..:|.|.:.|::..:.:..| .|:||:                      ||             
  Rat   244 SCSFCIWLLQSLIHILQLGQVWRYLHTI----------------------YL------------- 273

  Fly   116 SLAKERDDKQAEIEYYQKLMTEECNVSFVRLFDSFLESAPQKILQLAILLQ--STLEFTYYRHIA 178
            .:...:..:.:...:|.|::.|..:||.:.|..:|||||||.:|||.|::|  |......:...|
  Rat   274 GIRSRQSGESSRWRFYWKMVYEYADVSMLHLLATFLESAPQLVLQLCIIVQTHSLQALQGFTAAA 338

  Fly   179 LIVYFGNIAWCIQAYNHSNRLAQLDKHDIAAKGRFLQFLFLLCLTVIRFYFVVSRTLCIAYVASI 243
            .:|   ::||.:.:|..:.|.::.||..|:.....:||.:       .|:.:.:|.:..|..||:
  Rat   339 SLV---SLAWALASYQKALRDSRDDKKPISYMAVIIQFCW-------HFFTIAARVITFALFASV 393

  Fly   244 FPIE--------------TLIICATLACF--YGTIVFFVDSPMIAKSRPMNYSYCLCFGVVYLFI 292
            |.:.              .::.|.|..|.  :..|||    .|:.             |::|:|.
  Rat   394 FQLYFGIFIVLHWCIMTFWIVHCETEFCITKWEEIVF----DMVV-------------GIIYIFS 441

  Fly   293 FTPVKDAPTKYKYAFYLTFCLLQNIIACALYIPLYL--------ATAIIAL------YIVGIVLL 343
            :..||:..|:.:...|....||:|....||:   ||        |.||.||      ::.|:|.:
  Rat   442 WFNVKEGRTRCRLFIYYFVILLENTALSALW---YLYKAPQIADAFAIPALCVVFSSFLTGVVFM 503

  Fly   344 IIYYTYCHPNTVR 356
            ::||.:.|||..|
  Rat   504 LMYYAFFHPNGPR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 77/333 (23%)
Xkr4NP_001011971.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7885
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230316at2759
OrthoFinder 1 1.000 - - FOG0001048
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16024
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.980

Return to query results.
Submit another query.