DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and Capn3

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_058813.2 Gene:Capn3 / 29155 RGDID:2269 Length:821 Species:Rattus norvegicus


Alignment Length:146 Identity:28/146 - (19%)
Similarity:54/146 - (36%) Gaps:47/146 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LWRFVSICINWSLAYVYWMEESYGYCAWTIGSILVPMVVTSVIYIHTLKSAHAGEKRILERGVYS 95
            ||:.:..   |...:.::..:..|    ||.|             :.:::|      :.:.|.:.
  Rat   720 LWKKIKA---WQKIFKHYDTDHSG----TINS-------------YEMRNA------VNDAGFHL 758

  Fly    96 NAVISYLFRDVYVLNYAFKYSLAKERDDKQAEIEYYQKLMTEECNVSFVRLFDSF--LESAPQKI 158
            |   |.|: |:..:.||          ||...|::...:.   |.|....:|.:|  .:.....|
  Rat   759 N---SQLY-DIITMRYA----------DKHMNIDFDSFIC---CFVRLEGMFRAFHAFDKDGDGI 806

  Fly   159 LQLAILLQSTLEFTYY 174
            ::|.:|  ..|:.|.|
  Rat   807 IKLNVL--EWLQLTMY 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 28/146 (19%)
Capn3NP_058813.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Peptidase_C2 77..415 CDD:395523
Domain III 418..586
Calpain_III 436..574 CDD:395848
Calpain_u2 583..653 CDD:406940
Linker 587..649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 603..651
Domain IV 650..820 27/144 (19%)
EFh_PEF_CAPN3 653..821 CDD:320065 28/146 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.