DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and Capn2

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_058812.1 Gene:Capn2 / 29154 RGDID:2268 Length:700 Species:Rattus norvegicus


Alignment Length:214 Identity:43/214 - (20%)
Similarity:63/214 - (29%) Gaps:84/214 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WRFVSICINW----------SLAYVYWMEESY----------------GYCAWTIGSIL------ 64
            |:...:..||          :....:||...|                | |.:.:|.|.      
  Rat   356 WKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDDEDGERG-CTFLVGLIQKHRRRQ 419

  Fly    65 ----------------VPMVVTSVIYIHTLKSAHAGEKRILERGVYSNAVISYLFRDV------- 106
                            ||..:|....||..|:... ..|..||   |:..|:  .|:|       
  Rat   420 RKMGEDMHTIGFGIYEVPEELTGQTNIHLSKNFFL-TTRARER---SDTFIN--LREVLNRFKLP 478

  Fly   107 ---YVL---------NYAFKYSLAKER--------DDKQAEIEYYQKLMTEECNVSFVRLFDSFL 151
               |||         |..|...:..|:        |:.:|.||..: ...|:....|.|||....
  Rat   479 PGEYVLVPSTFEPHKNGDFCIRVFSEKKADYQTVDDEIEANIEEIE-ANEEDIGDGFRRLFAQLA 542

  Fly   152 -ESAPQKILQLAILLQSTL 169
             |.|.....:|..:|:..|
  Rat   543 GEDAEISAFELQTILRRVL 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 43/214 (20%)
Capn2NP_058812.1 Peptidase_C2 46..342 CDD:279042
Domain III 345..514 29/164 (18%)
Calpain_III 356..507 CDD:279416 29/157 (18%)
Linker 515..529 3/14 (21%)
Domain IV 530..700 9/32 (28%)
EFh 577..631 CDD:238008
FRQ1 604..>696 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.