powered by:
Protein Alignment CG32579 and Capn10
DIOPT Version :9
Sequence 1: | NP_001259606.1 |
Gene: | CG32579 / 318096 |
FlyBaseID: | FBgn0052579 |
Length: | 359 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_035926.2 |
Gene: | Capn10 / 23830 |
MGIID: | 1344392 |
Length: | 666 |
Species: | Mus musculus |
Alignment Length: | 63 |
Identity: | 17/63 - (26%) |
Similarity: | 28/63 - (44%) |
Gaps: | 10/63 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 ESYGYCAWTI--GSILVPMVVTSVIYIHTLKSAHAGEKRI-----LERGVYSNAVISYLFRDV 106
::.|...|.: ..|.:|.|:::.....| :.||.::.| |..|.|. ||.|...:||
Mouse 412 QAVGLHIWKVEKRKISLPRVLSAPPVAGT--ACHAYDREIHLRCELSPGYYL-AVPSTFLKDV 471
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0045 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.