DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and Xkr6

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_775569.2 Gene:Xkr6 / 219149 MGIID:2447765 Length:638 Species:Mus musculus


Alignment Length:385 Identity:86/385 - (22%)
Similarity:158/385 - (41%) Gaps:64/385 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LSMLLTVVSILWRFVSICINWSLAYVYWMEESYGYCAWTIGSILVPMVVTSVI------------ 73
            |..|..|:::|..|..:..:..||..|:.:..||....|:..:|||.::...:            
Mouse   124 LDCLWIVLALLVFFGDVGTDLWLALDYYRKGDYGCFGLTLFFVLVPSLLVQSLSFRWFVQDYTGG 188

  Fly    74 -------------------YIHTLK--------SAHAGEKRILERGVYSNAVISYLFRDVYVLNY 111
                               |.|...        ||..|.:|:....|:....:.:|.:...|..|
Mouse   189 GLGAVEGLSSRGPPMMGAGYGHGAARGGPGAGGSATPGAQRLCRLSVWIWQSVIHLLQMGQVWRY 253

  Fly   112 -AFKYSLAKERDDKQAEIEYYQKLMTEECNVSFVRLFDSFLESAPQKILQLAILLQSTLEFTYYR 175
             ...|...:.:..|:.:..:|..:|.|..:|:.:||.::|||||||.:|||.|::|.....| ..
Mouse   254 IRTMYLGIQSQRQKEHQRRFYWAMMYEYADVNMLRLLETFLESAPQLVLQLCIMIQKNSAET-LP 317

  Fly   176 HIALIVYFGNIAWCIQAYNHSNRLAQLDKHDIAAKGRFLQFLFLLCLTVIRFYFVVSRTLCIAYV 240
            .::.:....::||.:.:|:...|.::.||..::.:|..:...:       |.:.:.||.:..|..
Mouse   318 CVSSVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGALIHLFW-------RLFTISSRVISFALF 375

  Fly   241 ASIFPIETLIICATLACFYGTIVFFV--DSPMIAKSRPMNYSYCLCFGVVYLFIFTPVKDAPTKY 303
            ||||.:...|......|   .:.|::  .......|:.....:.:..|:||:|.:..||:..|:|
Mouse   376 ASIFQLYFGIFVVVHWC---AMAFWIIHGGTDFCMSKWEEILFNMVVGIVYIFCWFNVKEGRTRY 437

  Fly   304 KYAFYLTFCLLQNIIACALY--------IPLYLATAIIAL---YIVGIVLLIIYYTYCHP 352
            :...|.|..|.:|.....|:        ...|...|:..:   ::.||.|:::||...||
Mouse   438 RMFAYYTIVLTENAALTFLWYFYRNPESTDSYAVPALCCVFVSFVAGITLMLLYYGVLHP 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 84/381 (22%)
Xkr6NP_775569.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..117
XK-related 131..497 CDD:370717 81/376 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I8066
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H18287
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1230316at2759
OrthoFinder 1 1.000 - - FOG0001048
OrthoInspector 1 1.000 - - oto93423
orthoMCL 1 0.900 - - OOG6_105507
Panther 1 1.100 - - O PTHR16024
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5206
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.910

Return to query results.
Submit another query.