DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and clp-10

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001367887.1 Gene:clp-10 / 189220 WormBaseID:WBGene00021041 Length:476 Species:Caenorhabditis elegans


Alignment Length:212 Identity:43/212 - (20%)
Similarity:72/212 - (33%) Gaps:66/212 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EQRTEVD--ALMMGPISKLSMLLTVVSILWRFVSIC---------INWSLAYVYWMEESYGYCAW 58
            ||..||.  |...|..||...|..::        :|         |...:...|.:.:::    :
 Worm   260 EQLCEVSVTAFQKGSFSKEDNLTDLM--------VCVHKISEDGRIGELIKMSYEIADNH----F 312

  Fly    59 TIGSILVPMVVTSV-----------------IYIHT----------------LKSAHAGEKRILE 90
            ||....:|..|..|                 |.:||                |:|.|   :.|:|
 Worm   313 TIDEFFLPRGVYQVVCHSPHSLVTNTTGVVNIIVHTRFPIFGESVPMSPLTRLESLH---RVIIE 374

  Fly    91 RGVYSNAVISYLFRDVYVLNYAFKYSLAKERDDKQAEIEYYQKLM--TEECNVSFVRLFDSFLES 153
            .||..|..:..:.  :..||..|:.|:...  |...|.:|....:  ::..||...|......:.
 Worm   375 EGVVQNIKLDGVV--IRTLNQKFRGSITMV--DNYMEQKYLHVKVDNSKSMNVQSSRGSLLIADV 435

  Fly   154 APQKILQLAILLQSTLE 170
            .|.:..|:..:| ||::
 Worm   436 VPPRSRQVIAVL-STID 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 34/190 (18%)
clp-10NP_001367887.1 CysPc <1..241 CDD:412132
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.