Sequence 1: | NP_001259606.1 | Gene: | CG32579 / 318096 | FlyBaseID: | FBgn0052579 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001367887.1 | Gene: | clp-10 / 189220 | WormBaseID: | WBGene00021041 | Length: | 476 | Species: | Caenorhabditis elegans |
Alignment Length: | 212 | Identity: | 43/212 - (20%) |
---|---|---|---|
Similarity: | 72/212 - (33%) | Gaps: | 66/212 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 EQRTEVD--ALMMGPISKLSMLLTVVSILWRFVSIC---------INWSLAYVYWMEESYGYCAW 58
Fly 59 TIGSILVPMVVTSV-----------------IYIHT----------------LKSAHAGEKRILE 90
Fly 91 RGVYSNAVISYLFRDVYVLNYAFKYSLAKERDDKQAEIEYYQKLM--TEECNVSFVRLFDSFLES 153
Fly 154 APQKILQLAILLQSTLE 170 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32579 | NP_001259606.1 | XK-related | 25..353 | CDD:286853 | 34/190 (18%) |
clp-10 | NP_001367887.1 | CysPc | <1..241 | CDD:412132 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0045 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |