DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and clp-3

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_493052.3 Gene:clp-3 / 173089 WormBaseID:WBGene00000544 Length:752 Species:Caenorhabditis elegans


Alignment Length:233 Identity:39/233 - (16%)
Similarity:73/233 - (31%) Gaps:68/233 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DALMMGPISKLSMLLTVVSILWRFVSICIN-----WSLAYVYWMEESYGYCAWTIGSILVPMVVT 70
            |..|...::.|:|::..|.:  ..:.:|:|     ..:.....:.:.||||...:..:.......
 Worm   435 DIFMADEMAVLAMIMRGVQM--GSLIVCLNIDVNEKGVRQKNGLIKGYGYCITGVNLMETEWEKA 497

  Fly    71 SVIYIHT--------------------LKSAHAGEKRILERGVYSNAVISYL--FRDVYVLNYAF 113
            .:|.|.:                    |........||.|.|.:..::..::  |.|||..|.: 
 Worm   498 PLIRIRSPWGKVKWKGDFCYRSHRWFGLDKEKRESFRIKEDGEFWMSLKDFMVEFTDVYCCNLS- 561

  Fly   114 KYSLAKERDDKQAEIEYYQKLMTEECNVSF-----------------------------VRLFDS 149
              :......:|..|::..:....:....||                             .|..||
 Worm   562 --ADTMHEVEKMTEVKVMEHQSQQWIQASFEGEWSSRIGTAGGCDDHDTFCTNLQYEIHFRATDS 624

  Fly   150 FLESAPQKILQLAILLQSTLEFTYYRH-----IALIVY 182
            :  .:..|...:|.|.|...:...|:.     |.|:||
 Worm   625 Y--DSNHKCTIIAALFQKNRDHCVYKGLELFLIGLLVY 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 35/219 (16%)
clp-3NP_493052.3 MDN1 <5..136 CDD:227596
CysPc 254..559 CDD:238004 22/125 (18%)
Calpain_III 582..732 CDD:238132 14/81 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.