DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and Capn5

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_006507338.1 Gene:Capn5 / 12337 MGIID:1100859 Length:653 Species:Mus musculus


Alignment Length:109 Identity:21/109 - (19%)
Similarity:40/109 - (36%) Gaps:40/109 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WRFVSICIN-------WSLAYVYWMEESYG------------YCAWTIG---SILV----PMVVT 70
            | ||:.|.:       |......|.|:.:.            :..|..|   .::|    |.|..
Mouse    95 W-FVAACSSLASRESLWQKVIPDWKEQEWNPEKPDSYAGIFHFNFWRFGEWVDVIVDDRLPTVNN 158

  Fly    71 SVIYIHT----------LKSAH---AGEKRILERGVYSNAVISY 101
            .:||.|:          ::.|:   ||..:.|:.|..::|::.:
Mouse   159 QLIYCHSNSKNEFWCALVEKAYAKLAGCYQALDGGNTADALVDF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 21/109 (19%)
Capn5XP_006507338.1 Peptidase_C2 40..354 CDD:366222 21/109 (19%)
Calpain_III 365..511 CDD:238132
C2_Calpain 528..651 CDD:176011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.