DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32579 and CAPN10

DIOPT Version :9

Sequence 1:NP_001259606.1 Gene:CG32579 / 318096 FlyBaseID:FBgn0052579 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_075571.2 Gene:CAPN10 / 11132 HGNCID:1477 Length:672 Species:Homo sapiens


Alignment Length:60 Identity:17/60 - (28%)
Similarity:21/60 - (35%) Gaps:15/60 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 RFLQFLFLLCLTVIRFYFVVSRTLCIAYVASIFPIETLIICATLACFYGTIVFFVDSPMI 271
            |:.|.:..|||.....|.||..|    |:..           |...|..||...:|.|.|
Human   607 RYAQEVSRLCLLPAGTYKVVPST----YLPD-----------TEGAFTVTIATRIDRPSI 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32579NP_001259606.1 XK-related 25..353 CDD:286853 17/60 (28%)
CAPN10NP_075571.2 CysPc 2..319 CDD:238004
Domain III 1 322..494
Calpain_III 335..496 CDD:238132
Calpain_III 512..653 CDD:238132 17/60 (28%)
Domain III 2 513..654 17/60 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.