| Sequence 1: | NP_001259606.1 | Gene: | CG32579 / 318096 | FlyBaseID: | FBgn0052579 | Length: | 359 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011542319.1 | Gene: | CAPN9 / 10753 | HGNCID: | 1486 | Length: | 721 | Species: | Homo sapiens |
| Alignment Length: | 195 | Identity: | 46/195 - (23%) |
|---|---|---|---|
| Similarity: | 68/195 - (34%) | Gaps: | 49/195 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 107 YVLNYAFKYSLAKERDDKQAEIEYYQKLMTEECNVSFVRLFDSF----LESAPQKIL--QLAILL 165
Fly 166 QSTLEFTYYRHIALIVYFGNIAWCIQAYNHSNRLAQLDKHDIAAKGRFLQF-LFLLCLTVIRFYF 229
Fly 230 VVSRTLCIAYVASIFPIET---LIICATLAC---------------FYGTIVFFVDSPMIAKSRP 276
Fly 277 276 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG32579 | NP_001259606.1 | XK-related | 25..353 | CDD:286853 | 46/195 (24%) |
| CAPN9 | XP_011542319.1 | Peptidase_C2 | 43..335 | CDD:279042 | |
| Calpain_III | 349..491 | CDD:279416 | |||
| PTZ00184 | 514..657 | CDD:185504 | 32/123 (26%) | ||
| EFh | 566..621 | CDD:238008 | 11/55 (20%) | ||
| EFh | 600..652 | CDD:298682 | 11/51 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0045 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||