DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32576 and GOT1

DIOPT Version :9

Sequence 1:NP_001014746.1 Gene:CG32576 / 318095 FlyBaseID:FBgn0052576 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_014020.1 Gene:GOT1 / 855337 SGDID:S000004906 Length:138 Species:Saccharomyces cerevisiae


Alignment Length:130 Identity:51/130 - (39%)
Similarity:76/130 - (58%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISDLQKIGIGLAGFGIFFLFLGMLLLFDKGLLAIGNILFISGLACVIGVERTMRFFFQRHKVKGT 68
            :::.||.|:.....|..|...|:...||:.|||:|||||:.|:..:||.::|..||.:.:|.:|:
Yeast     3 LTEAQKFGVAFTFGGFLFFLFGIFTFFDRALLALGNILFLIGVFLIIGSQKTYIFFTRPNKRRGS 67

  Fly    69 TAFLGGIVIVLLGFPIFGMIIESYGFFALFSGFFPVAINFLGRVPVLGSLFNLPFIQKIVQKLGG 133
            ..||.|..::||.:...|.||||.|...||..||.|.:.||..:|::|.:.:.|.|..||.||.|
Yeast    68 LFFLVGAFLILLKWTFLGFIIESLGIIGLFGDFFGVIVQFLRSMPIIGPILSHPAIAPIVDKLAG 132

  Fly   134  133
            Yeast   133  132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32576NP_001014746.1 Got1 4..116 CDD:295188 43/111 (39%)
GOT1NP_014020.1 GOT1 1..138 CDD:227450 51/130 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I1970
eggNOG 1 0.900 - - E1_COG0284
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41102
Inparanoid 1 1.050 104 1.000 Inparanoid score I1428
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54053
OrthoFinder 1 1.000 - - FOG0001830
OrthoInspector 1 1.000 - - oto99216
orthoMCL 1 0.900 - - OOG6_101505
Panther 1 1.100 - - LDO PTHR21493
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2552
SonicParanoid 1 1.000 - - X1194
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.