DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32576 and AT1G05785

DIOPT Version :9

Sequence 1:NP_001014746.1 Gene:CG32576 / 318095 FlyBaseID:FBgn0052576 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001320876.1 Gene:AT1G05785 / 837087 AraportID:AT1G05785 Length:173 Species:Arabidopsis thaliana


Alignment Length:122 Identity:47/122 - (38%)
Similarity:81/122 - (66%) Gaps:0/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EISDLQKIGIGLAGFGIFFLFLGMLLLFDKGLLAIGNILFISGLACVIGVERTMRFFFQRHKVKG 67
            ||::.:|:|:||.|||:.|.|||::|.||:||||:||:.::.|:..::|.:.|.|.|...:.::|
plant     4 EITEQKKVGLGLIGFGLSFTFLGVILYFDRGLLALGNLFWLIGVGLLLGWQSTWRVFTNVNNLRG 68

  Fly    68 TTAFLGGIVIVLLGFPIFGMIIESYGFFALFSGFFPVAINFLGRVPVLGSLFNLPFI 124
            |..|:.|:.::.:.:||.|:|:|.||...||.||:.....||.::|.:|.:...|.:
plant    69 TICFVLGLFLIFVRWPIIGIILEIYGVIVLFGGFWSTVKAFLSQIPFVGWIIQYPLM 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32576NP_001014746.1 Got1 4..116 CDD:295188 44/111 (40%)
AT1G05785NP_001320876.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0284
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54053
OrthoDB 1 1.010 - - D1534843at2759
OrthoFinder 1 1.000 - - FOG0001830
OrthoInspector 1 1.000 - - otm3263
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21493
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1194
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.890

Return to query results.
Submit another query.