DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32576 and AT5G01430

DIOPT Version :9

Sequence 1:NP_001014746.1 Gene:CG32576 / 318095 FlyBaseID:FBgn0052576 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001190200.1 Gene:AT5G01430 / 831915 AraportID:AT5G01430 Length:140 Species:Arabidopsis thaliana


Alignment Length:131 Identity:68/131 - (51%)
Similarity:95/131 - (72%) Gaps:0/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EISDLQKIGIGLAGFGIFFLFLGMLLLFDKGLLAIGNILFISGLACVIGVERTMRFFFQRHKVKG 67
            |::|.:|||:||.|||:||.|||::.:|||||||:||||||||::..||.:.||:||.:|...||
plant     5 EMNDRKKIGLGLTGFGVFFSFLGIVFVFDKGLLAMGNILFISGVSLTIGFKSTMQFFMKRQNYKG 69

  Fly    68 TTAFLGGIVIVLLGFPIFGMIIESYGFFALFSGFFPVAINFLGRVPVLGSLFNLPFIQKIVQKLG 132
            |.:|..|...|::|:||.||::|:||||.|||||:|....|..::||||.:...|:|:....|..
plant    70 TISFGVGFFFVIIGWPILGMMLETYGFFVLFSGFWPTLAVFAQKIPVLGWIIQQPYIRSFFDKYR 134

  Fly   133 G 133
            |
plant   135 G 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32576NP_001014746.1 Got1 4..116 CDD:295188 61/111 (55%)
AT5G01430NP_001190200.1 Got1 6..123 CDD:413209 63/116 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 113 1.000 Domainoid score I2038
eggNOG 1 0.900 - - E1_COG0284
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41102
Inparanoid 1 1.050 148 1.000 Inparanoid score I1731
OMA 1 1.010 - - QHG54053
OrthoDB 1 1.010 - - D1534843at2759
OrthoFinder 1 1.000 - - FOG0001830
OrthoInspector 1 1.000 - - otm3263
orthoMCL 1 0.900 - - OOG6_101505
Panther 1 1.100 - - LDO PTHR21493
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1194
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.