DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32576 and Golt1a

DIOPT Version :9

Sequence 1:NP_001014746.1 Gene:CG32576 / 318095 FlyBaseID:FBgn0052576 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_080956.1 Gene:Golt1a / 68338 MGIID:1915588 Length:133 Species:Mus musculus


Alignment Length:136 Identity:75/136 - (55%)
Similarity:101/136 - (74%) Gaps:6/136 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIEISDLQKIGIGLAGFGIFFLFLGMLLLFDKGLLAIGNILFISGLACVIGVERTMRFFFQRHKV 65
            ||.|::.||||:|:.|||:||:..|:||.||..|||.||:||::||:.:||:.||..|||||||:
Mouse     1 MISITEWQKIGVGITGFGVFFILFGILLYFDSVLLAFGNLLFLTGLSLIIGLRRTFAFFFQRHKL 65

  Fly    66 KGTTAFLGGIVIVLLGFPIFGMIIESYGFFALFSGFFPVAINFLGRVPVLGSLFNLPFIQKIVQK 130
            |||:.||||:.||||.:|:.||::|:|||.:||.|||||...|      |||.||:||:..:.||
Mouse    66 KGTSFFLGGVAIVLLRWPLLGMLLEAYGFISLFKGFFPVVFGF------LGSAFNIPFLSTLFQK 124

  Fly   131 LGGDGN 136
            |.|..:
Mouse   125 LQGSSS 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32576NP_001014746.1 Got1 4..116 CDD:295188 62/111 (56%)
Golt1aNP_080956.1 Got1 4..109 CDD:321819 62/110 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850771
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54053
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001830
OrthoInspector 1 1.000 - - oto92551
orthoMCL 1 0.900 - - OOG6_101505
Panther 1 1.100 - - O PTHR21493
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2552
SonicParanoid 1 1.000 - - X1194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.