DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32576 and GOLT1B

DIOPT Version :9

Sequence 1:NP_001014746.1 Gene:CG32576 / 318095 FlyBaseID:FBgn0052576 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_024304767.1 Gene:GOLT1B / 51026 HGNCID:20175 Length:236 Species:Homo sapiens


Alignment Length:136 Identity:88/136 - (64%)
Similarity:108/136 - (79%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIEISDLQKIGIGLAGFGIFFLFLGMLLLFDKGLLAIGNILFISGLACVIGVERTMRFFFQRHKV 65
            ||.::|.||||:||.|||:||||.||:|.|||.||||||:||::|||.|||:|||.|||||:||:
Human    99 MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKM 163

  Fly    66 KGTTAFLGGIVIVLLGFPIFGMIIESYGFFALFSGFFPVAINFLGRVPVLGSLFNLPFIQKIVQK 130
            |.|..||||:.:||:|:|:.|||.|.||||.||.|||||.:.|:.||||||||.|||.|:..|.|
Human   164 KATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDK 228

  Fly   131 LGGDGN 136
            :|...|
Human   229 VGESNN 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32576NP_001014746.1 Got1 4..116 CDD:295188 74/111 (67%)
GOLT1BXP_024304767.1 Got1 102..218 CDD:321819 78/115 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160415
Domainoid 1 1.000 141 1.000 Domainoid score I4742
eggNOG 1 0.900 - - E1_COG0284
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41102
Inparanoid 1 1.050 190 1.000 Inparanoid score I3897
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54053
OrthoDB 1 1.010 - - D1534843at2759
OrthoFinder 1 1.000 - - FOG0001830
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101505
Panther 1 1.100 - - LDO PTHR21493
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2552
SonicParanoid 1 1.000 - - X1194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.