DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32576 and golt1b

DIOPT Version :9

Sequence 1:NP_001014746.1 Gene:CG32576 / 318095 FlyBaseID:FBgn0052576 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001011254.1 Gene:golt1b / 496701 XenbaseID:XB-GENE-5753086 Length:138 Species:Xenopus tropicalis


Alignment Length:136 Identity:88/136 - (64%)
Similarity:107/136 - (78%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIEISDLQKIGIGLAGFGIFFLFLGMLLLFDKGLLAIGNILFISGLACVIGVERTMRFFFQRHKV 65
            ||.::|.||||:||.|||:|||..||||.|||.||||||:||::|||.|||:|||.|||||:|||
 Frog     1 MISLTDSQKIGMGLTGFGVFFLIFGMLLFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKV 65

  Fly    66 KGTTAFLGGIVIVLLGFPIFGMIIESYGFFALFSGFFPVAINFLGRVPVLGSLFNLPFIQKIVQK 130
            |.|..||||:.:||:|:|:.||::|.||||.||.|||||.|.|:.|:||||||.|||.|..:|.|
 Frog    66 KATGFFLGGVFVVLVGWPLIGMVLEIYGFFLLFRGFFPVVIGFIRRIPVLGSLLNLPGISSLVDK 130

  Fly   131 LGGDGN 136
            .|...|
 Frog   131 AGESNN 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32576NP_001014746.1 Got1 4..116 CDD:295188 74/111 (67%)
golt1bNP_001011254.1 Got1 4..120 CDD:321819 78/115 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 141 1.000 Domainoid score I4696
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41102
Inparanoid 1 1.050 180 1.000 Inparanoid score I3889
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1534843at2759
OrthoFinder 1 1.000 - - FOG0001830
OrthoInspector 1 1.000 - - oto102850
Panther 1 1.100 - - LDO PTHR21493
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.