DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32576 and txt-8

DIOPT Version :9

Sequence 1:NP_001014746.1 Gene:CG32576 / 318095 FlyBaseID:FBgn0052576 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001379246.1 Gene:txt-8 / 191267 WormBaseID:WBGene00013950 Length:353 Species:Caenorhabditis elegans


Alignment Length:140 Identity:32/140 - (22%)
Similarity:45/140 - (32%) Gaps:55/140 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FLGMLLLFDKGLLAIGNILFISGLACVIGVERTMRFF--------FQRHKVKGTTAFLGG----- 74
            |.||      ||:   |..|.|      |.|:|.::.        ::.:.|..|...|||     
 Worm   122 FYGM------GLV---NTYFRS------GHEKTWQYVQDALSISQYRNYDVYVTGHSLGGALAGL 171

  Fly    75 ---------------IVIVLLGFPIFGMI--------IESYGFFALFSG----FFPVAINFLGRV 112
                           |.:|..|.|..|.|        :..|.|..:.||    ..|..:..|...
 Worm   172 CAPRIVHDGLRQSQKIKVVTFGEPRVGNIEFSRAYDQLVPYSFRVVHSGDVVPHLPGCVKDLSYT 236

  Fly   113 PVLGSLFNLP 122
            |..||..::|
 Worm   237 PPAGSDGSMP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32576NP_001014746.1 Got1 4..116 CDD:295188 29/132 (22%)
txt-8NP_001379246.1 Lipase_3 97..230 CDD:396362 27/122 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156118
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.