powered by:
Protein Alignment CG32576 and txt-4
DIOPT Version :9
Sequence 1: | NP_001014746.1 |
Gene: | CG32576 / 318095 |
FlyBaseID: | FBgn0052576 |
Length: | 140 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_500090.3 |
Gene: | txt-4 / 176959 |
WormBaseID: | WBGene00019368 |
Length: | 339 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 16/68 - (23%) |
Similarity: | 25/68 - (36%) |
Gaps: | 8/68 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 ILFISGLACVIGVERTMRFFFQRHKVKGT-----TAFLGGIVIVLLGFPIFGMIIESY--GFFAL 97
||.::..|.:..|:.|.:......:...| ..||...|.....|. .|.|.|.: .:.||
Worm 112 ILPLTQCAMITAVDTTQKVLVMSFRATNTGTQLEEEFLNYFVAKKAFFD-SGYIFEFFYDAYLAL 175
Fly 98 FSG 100
:.|
Worm 176 WKG 178
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160156115 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.