DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32576 and txt-4

DIOPT Version :9

Sequence 1:NP_001014746.1 Gene:CG32576 / 318095 FlyBaseID:FBgn0052576 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_500090.3 Gene:txt-4 / 176959 WormBaseID:WBGene00019368 Length:339 Species:Caenorhabditis elegans


Alignment Length:68 Identity:16/68 - (23%)
Similarity:25/68 - (36%) Gaps:8/68 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ILFISGLACVIGVERTMRFFFQRHKVKGT-----TAFLGGIVIVLLGFPIFGMIIESY--GFFAL 97
            ||.::..|.:..|:.|.:......:...|     ..||...|.....|. .|.|.|.:  .:.||
 Worm   112 ILPLTQCAMITAVDTTQKVLVMSFRATNTGTQLEEEFLNYFVAKKAFFD-SGYIFEFFYDAYLAL 175

  Fly    98 FSG 100
            :.|
 Worm   176 WKG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32576NP_001014746.1 Got1 4..116 CDD:295188 16/68 (24%)
txt-4NP_500090.3 Lipase_3 132..268 CDD:366799 11/48 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156115
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.