DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32576 and eas-1

DIOPT Version :9

Sequence 1:NP_001014746.1 Gene:CG32576 / 318095 FlyBaseID:FBgn0052576 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_494847.2 Gene:eas-1 / 173819 WormBaseID:WBGene00018270 Length:141 Species:Caenorhabditis elegans


Alignment Length:129 Identity:63/129 - (48%)
Similarity:93/129 - (72%) Gaps:0/129 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EISDLQKIGIGLAGFGIFFLFLGMLLLFDKGLLAIGNILFISGLACVIGVERTMRFFFQRHKVKG 67
            |:|..::||:||..||.||:|||:|:..|..||||||:|||.|:..:|||:||:.|||:..|:||
 Worm     5 EVSTTKQIGVGLTTFGFFFIFLGVLMFLDSALLAIGNLLFIVGITFIIGVQRTLVFFFEFRKLKG 69

  Fly    68 TTAFLGGIVIVLLGFPIFGMIIESYGFFALFSGFFPVAINFLGRVPVLGSLFNLPFIQKIVQKL 131
            :..|.|||::||.|:|:||||.|.:||..||.||.|..:|.|..:|.:.::..||.|::::.:|
 Worm    70 SILFFGGILVVLFGYPLFGMIAECWGFIVLFGGFLPGIVNLLRSIPGISTITYLPGIRQVLDRL 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32576NP_001014746.1 Got1 4..116 CDD:295188 58/111 (52%)
eas-1NP_494847.2 Got1 6..130 CDD:382858 61/123 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I3788
eggNOG 1 0.900 - - E1_COG0284
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41102
Inparanoid 1 1.050 141 1.000 Inparanoid score I3069
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54053
OrthoDB 1 1.010 - - D1534843at2759
OrthoFinder 1 1.000 - - FOG0001830
OrthoInspector 1 1.000 - - oto18483
orthoMCL 1 0.900 - - OOG6_101505
Panther 1 1.100 - - LDO PTHR21493
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2552
SonicParanoid 1 1.000 - - X1194
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.870

Return to query results.
Submit another query.