DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32576 and GOLT1A

DIOPT Version :9

Sequence 1:NP_001014746.1 Gene:CG32576 / 318095 FlyBaseID:FBgn0052576 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_940849.1 Gene:GOLT1A / 127845 HGNCID:24766 Length:132 Species:Homo sapiens


Alignment Length:133 Identity:74/133 - (55%)
Similarity:99/133 - (74%) Gaps:6/133 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIEISDLQKIGIGLAGFGIFFLFLGMLLLFDKGLLAIGNILFISGLACVIGVERTMRFFFQRHKV 65
            ||.|::.||||:|:.||||||:..|.||.||..|||.||:||::||:.:||:.:|..|||||||:
Human     1 MISITEWQKIGVGITGFGIFFILFGTLLYFDSVLLAFGNLLFLTGLSLIIGLRKTFWFFFQRHKL 65

  Fly    66 KGTTAFLGGIVIVLLGFPIFGMIIESYGFFALFSGFFPVAINFLGRVPVLGSLFNLPFIQKIVQK 130
            |||:..|||:|||||.:|:.||.:|:||||:||.||||||..|||.|      .|:||:..:.::
Human    66 KGTSFLLGGVVIVLLRWPLLGMFLETYGFFSLFKGFFPVAFGFLGNV------CNIPFLGALFRR 124

  Fly   131 LGG 133
            |.|
Human   125 LQG 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32576NP_001014746.1 Got1 4..116 CDD:295188 67/111 (60%)
GOLT1ANP_940849.1 Got1 4..109 CDD:321819 63/104 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160414
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0284
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54053
OrthoDB 1 1.010 - - D1534843at2759
OrthoFinder 1 1.000 - - FOG0001830
OrthoInspector 1 1.000 - - oto88986
orthoMCL 1 0.900 - - OOG6_101505
Panther 1 1.100 - - O PTHR21493
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2552
SonicParanoid 1 1.000 - - X1194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.750

Return to query results.
Submit another query.