DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32576 and golt1ba

DIOPT Version :9

Sequence 1:NP_001014746.1 Gene:CG32576 / 318095 FlyBaseID:FBgn0052576 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001314769.1 Gene:golt1ba / 100034417 ZFINID:ZDB-GENE-041210-157 Length:138 Species:Danio rerio


Alignment Length:136 Identity:87/136 - (63%)
Similarity:107/136 - (78%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIEISDLQKIGIGLAGFGIFFLFLGMLLLFDKGLLAIGNILFISGLACVIGVERTMRFFFQRHKV 65
            ||.:||.||||:||.|||:||||.||:|.|||.|||||||||:.|||.|||:|||.|||||:||:
Zfish     1 MISLSDSQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNILFVVGLAFVIGLERTFRFFFQKHKM 65

  Fly    66 KGTTAFLGGIVIVLLGFPIFGMIIESYGFFALFSGFFPVAINFLGRVPVLGSLFNLPFIQKIVQK 130
            |.|:.||||:.:||:|:||.|:::|.||||.||.|||||.:.|:.|:||||.|.|||||...|.|
Zfish    66 KATSFFLGGVFVVLIGWPIVGVVLEFYGFFLLFRGFFPVVVGFIRRIPVLGYLLNLPFISGYVDK 130

  Fly   131 LGGDGN 136
            :....|
Zfish   131 MSESNN 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32576NP_001014746.1 Got1 4..116 CDD:295188 74/111 (67%)
golt1baNP_001314769.1 Got1 4..116 CDD:295188 74/111 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596790
Domainoid 1 1.000 142 1.000 Domainoid score I4625
eggNOG 1 0.900 - - E1_COG0284
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3892
OMA 1 1.010 - - QHG54053
OrthoDB 1 1.010 - - D1534843at2759
OrthoFinder 1 1.000 - - FOG0001830
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101505
Panther 1 1.100 - - O PTHR21493
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2552
SonicParanoid 1 1.000 - - X1194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.