DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32576 and golt1a

DIOPT Version :9

Sequence 1:NP_001014746.1 Gene:CG32576 / 318095 FlyBaseID:FBgn0052576 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_001336385.1 Gene:golt1a / 100001834 ZFINID:ZDB-GENE-141212-320 Length:133 Species:Danio rerio


Alignment Length:133 Identity:73/133 - (54%)
Similarity:96/133 - (72%) Gaps:6/133 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIEISDLQKIGIGLAGFGIFFLFLGMLLLFDKGLLAIGNILFISGLACVIGVERTMRFFFQRHKV 65
            ||.|::.||||:||:|||:||:..|:||.||..|||.|||||:||||.:||::||..|||||.|:
Zfish     1 MIAITEFQKIGVGLSGFGVFFVLFGILLYFDSVLLAFGNILFLSGLAFIIGLKRTAHFFFQRQKL 65

  Fly    66 KGTTAFLGGIVIVLLGFPIFGMIIESYGFFALFSGFFPVAINFLGRVPVLGSLFNLPFIQKIVQK 130
            :.:..||||:.:|||.:|..||::|:|||..||..|||||..||..|      ||:||:..|:.|
Zfish    66 RSSAFFLGGVALVLLRWPRIGMLVETYGFVLLFKSFFPVAFGFLATV------FNIPFLTTILNK 124

  Fly   131 LGG 133
            |.|
Zfish   125 LSG 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32576NP_001014746.1 Got1 4..116 CDD:295188 63/111 (57%)
golt1aXP_001336385.1 Got1 4..112 CDD:295188 62/107 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596792
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0284
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54053
OrthoDB 1 1.010 - - D1534843at2759
OrthoFinder 1 1.000 - - FOG0001830
OrthoInspector 1 1.000 - - oto39195
orthoMCL 1 0.900 - - OOG6_101505
Panther 1 1.100 - - O PTHR21493
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2552
SonicParanoid 1 1.000 - - X1194
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.750

Return to query results.
Submit another query.