DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlX and TwdlE

DIOPT Version :9

Sequence 1:NP_728016.1 Gene:TwdlX / 318094 FlyBaseID:FBgn0052571 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster


Alignment Length:153 Identity:50/153 - (32%)
Similarity:71/153 - (46%) Gaps:28/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SSSYQVGSSSVGGGIVNDNIGLAGLQPGPTINYNEQESYISHLANFQPAQINKHFYIHSAPEDHD 161
            |||||....|.|.|             .|...|...:         |...|:||.|:|..|.:.:
  Fly    33 SSSYQPSGPSGGYG-------------APAPQYGPPQ---------QAPVIHKHVYVHVPPPEPE 75

  Fly   162 EQQIVRYVNVGRPQKNYRVVFINAPTSTASKAKIIANVAPVEEKTAIYVLSKKSNALDVTAEVVT 226
            .|...:.:.|..|||:|::|||.||:.....|.:|......||||.:|||.||.   :...|::.
  Fly    76 YQAPRKPLYVPPPQKHYKIVFIKAPSPPVPTAPVIPQFPQNEEKTLVYVLVKKP---EEQPEIII 137

  Fly   227 QRPV---ANKPEVFFVKYKTPQE 246
            ..|.   .:||||:|::|||.:|
  Fly   138 PTPAPTQPSKPEVYFIRYKTQKE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlXNP_728016.1 DUF243 148..241 CDD:281144 34/95 (36%)
TwdlENP_609157.3 DM5 59..158 CDD:214776 37/101 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.