DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlY and TwdlE

DIOPT Version :9

Sequence 1:NP_728017.1 Gene:TwdlY / 318093 FlyBaseID:FBgn0052570 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster


Alignment Length:187 Identity:70/187 - (37%)
Similarity:90/187 - (48%) Gaps:30/187 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVSCLILVALTQARPQ---YGYEQPSSDIFIGGGSAPVGGVGIGGSSGGGLVSIQPHRGGDKYL 67
            |||..:.|.||..|||:   ..|..|.|..:...|  |.||.|               ....:|.
  Fly     6 VLVVLMALAALVAARPEPPRDSYSAPPSSSYQPSG--PSGGYG---------------APAPQYG 53

  Fly    68 PPASTTLAPIINKKFYLVSAPEDHSNDGKVKHLVLGRPQKNYRVVFIKAPAGDNANVKYSAEFAP 132
            ||..   ||:|:|..|:...|.:.......|.|.:..|||:|::||||||:..........:|..
  Fly    54 PPQQ---APVIHKHVYVHVPPPEPEYQAPRKPLYVPPPQKHYKIVFIKAPSPPVPTAPVIPQFPQ 115

  Fly   133 QEEKTVIYVLSKKDNDVDASDIATPAPTQPSKPEVFFIKYKTDDEAKQAQQEIQGQY 189
            .||||::|||.||..:.....|.||||||||||||:||:|||       |:|..|.|
  Fly   116 NEEKTLVYVLVKKPEEQPEIIIPTPAPTQPSKPEVYFIRYKT-------QKEETGPY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlYNP_728017.1 DM5 76..175 CDD:214776 44/98 (45%)
TwdlENP_609157.3 DM5 59..158 CDD:214776 45/105 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450404
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.