DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlZ and TwdlE

DIOPT Version :9

Sequence 1:NP_728018.2 Gene:TwdlZ / 318092 FlyBaseID:FBgn0052569 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster


Alignment Length:177 Identity:58/177 - (32%)
Similarity:82/177 - (46%) Gaps:37/177 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SWAQGSRYLPPPN---PAMEPIITKQFYSISPAEDPEDLEPRTKHLVIGQPRRNYRVIFIRAPTG 77
            |...|....|.|.   |...|:|.|..|...|..:||...|| |.|.:..|:::|:::||:||  
  Fly    39 SGPSGGYGAPAPQYGPPQQAPVIHKHVYVHVPPPEPEYQAPR-KPLYVPPPQKHYKIVFIKAP-- 100

  Fly    78 NSEHVKYTAELAPQ----EERTVIYVLTRKQQELEAADIMAPQQKSQVEQKPDVFFIKYKTNDEA 138
             |..|. ||.:.||    ||:|::|||.:|.:  |..:|:.|........||:|:||:|||..|.
  Fly   101 -SPPVP-TAPVIPQFPQNEEKTLVYVLVKKPE--EQPEIIIPTPAPTQPSKPEVYFIRYKTQKEE 161

  Fly   139 AAAQREIQTQYDQLGGNTEIAAPY---VAPIKSVIGALSSPQYPAAP 182
                                ..||   |||.....||.::|..|:||
  Fly   162 --------------------TGPYPNSVAPPAPEYGAPAAPPAPSAP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlZNP_728018.2 DUF243 36..132 CDD:281144 36/99 (36%)
TwdlENP_609157.3 DM5 59..158 CDD:214776 40/105 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.