DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG18765

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:365 Identity:74/365 - (20%)
Similarity:143/365 - (39%) Gaps:67/365 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 DEKQLEISVIVKA---MPDNLHRRRLFRSVIFFRNEINFYTKVLPAI-EAFQKSRQPAPKKPFVE 126
            |.|:.::|.::|:   :|..|...|...    |..|.:.:..||||: |.:|.|.:.....|.|.
  Fly    64 DNKKRQVSYLIKSPETVPVGLKLPRTGD----FSTERHMFEVVLPALEELYQNSDRIVHFGPPVI 124

  Fly   127 YPRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYISLEDALLTMRTLGRFHGVALAFNALDSKNF 191
            ..:..:|...|  |:|.     .:||........:|:......:..|..:|....|:.|      
  Fly   125 QAKLKSSHIYG--DYIL-----NKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIA------ 176

  Fly   192 EKAAGSLEETYYGEHTREWYTGFLLLAENVATD----AVKQIYPNSKYETVATNFLQPPLFDDLI 252
             |..|.:.|             ...|.||..:|    .:|.:|....:|::.:|..:.  ::|.:
  Fly   177 -KTPGKIRE-------------LPKLRENSKSDEETAELKSLYQLRFHESLRSNDARQ--YEDKV 225

  Fly   253 -----------NLVSTRSKLSVFGHGDCWTPNFLTKYNERGQSEEIIIIDFQLARCSSLALDLSF 306
                       .::.:::..:|..:|.||..|.|.:.:..|..::.:...|..|:......||  
  Fly   226 KSFQKYVKSGTEILDSKTSFNVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDL-- 288

  Fly   307 FIYSCTSQELREQHYDELLRAYLESAQDLIQDLG-----GNAESIISWESLQEELKNFGRFGCGM 366
            |....|:...:...:|..::.|.:   .||::|.     |...|:   ..||.:|..:|.:....
  Fly   289 FSSLLTAPAEKSSRFDGYVKFYHD---QLIENLNLLKFLGKKPSL---TDLQLDLLKYGHWAFET 347

  Fly   367 GIESLPMTMMEDDEVADLDGIKENAILTD-IWNITPFKES 405
            ..|.||: ::.|....|::.:..|.:..: |..:.|:.|:
  Fly   348 ATEILPI-VLSDFGNNDIEELFRNPVFGEQIRELLPWMEN 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 58/292 (20%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 59/296 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.