DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG10562

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster


Alignment Length:390 Identity:85/390 - (21%)
Similarity:171/390 - (43%) Gaps:31/390 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STFPSF--ADISAKFSEATLDEIIRNAGGTRHTSYKFGPSGKKGDAYLSRVFRITIYGVKEAEEG 64
            |..|.:  |:|.....:|.:|      |.::..::|.......|:.|.:.:.|     ||...|.
  Fly     4 SKIPDWVTAEIFEDLLKANVD------GYSKIKNFKADIGSAAGENYATIMLR-----VKIEVEL 57

  Fly    65 QDEKQLEISVIVKAMPDNLHR-RRLFRSVIFFRNEINFYTKVLPAIEAFQKSRQPAPKKPFVEYP 128
            ||.|...:|.:|| :|..:.. :.:.:....|..|...|.:|:|.:||..|:     ....:.:.
  Fly    58 QDGKSKSVSYMVK-LPHQVEAIQEMMKRTNIFEIERTMYNEVVPELEALYKA-----VGVDITFG 116

  Fly   129 RCLASLCDGVNDFIALEDVGPRGYRAPVRQDYISLEDALLTMRTLGRFHGVALAFNALDSKNFEK 193
            .....|.:...|::||||:|.:|::...|.:.:..|.....:|.|.::| .|.|........:.|
  Fly   117 AKNYDLKNAKTDYVALEDLGLKGFKNANRLEGLDQEHTERVLRKLSQWH-AASAVRVATKGPYPK 180

  Fly   194 AAGSLEETYYGEHTREWYTGFLLLAENVATDAVKQIYPNSKYETV--ATNFLQPPLFDDLINLVS 256
            .   |.:.::.|.:|...:..:   :.:..:.||.......:|..  ....|||...|.:.....
  Fly   181 I---LLQGFFKEESRPVMSEMI---KGMGANFVKSCATYEGHEAYLDKVKALQPVAIDKIFEFAK 239

  Fly   257 TR-SKLSVFGHGDCWTPNFLTKYNERGQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQH 320
            .. ::.:|..|||.|:.|.:.:|:..|:.:|:.::|:||.:..::|.||.:|:.|.|..|.:...
  Fly   240 VEPTEFNVLNHGDSWSNNIMFQYDAFGKIKEVYLVDYQLPKYGTVAQDLLYFLLSSTKLEDKLAK 304

  Fly   321 YDELLRAYLESAQDLIQDLGGNAESIISWESLQEELKNFGRFGCGMGIESLPMTMMEDDEVADLD 385
            :|..::.|.::..:.::.| ..::.|.|...:...|..:|.||..:....:...:::..:.|.|:
  Fly   305 FDYYIKIYHDNLVEHLKIL-KYSKPIPSLRDIHLALFKYGYFGYTVATGVMSAVLLDPTDSASLE 368

  Fly   386  385
              Fly   369  368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 68/301 (23%)
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 69/302 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
33.010

Return to query results.
Submit another query.