DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG10560

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster


Alignment Length:395 Identity:81/395 - (20%)
Similarity:161/395 - (40%) Gaps:60/395 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EATLDEIIRNAGGTRHTSYKFGPSGKKGDAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMP 80
            |..|.:.:::...|:....|.|.:.  |:.|.:.:.|:.:     ..|.:|:.::..:.::|...
  Fly    27 EDLLKDNVKDYKKTKALRAKAGVAA--GENYATIMLRLEL-----DVETKDKSEVTKAFMLKTPH 84

  Fly    81 DNLHRRRLFRSVIFFRNEINFYTKVLPAIEAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALE 145
            |....|:|.:....|..|...|..|:|.:|...:.                          :.||
  Fly    85 DTDAYRKLLQETNIFDVERGMYLVVVPELEQMYRD--------------------------VGLE 123

  Fly   146 -DVGPRGYRAPVRQDYISLEDALLTMRTLG-----RFHGVALAFNALDSKNFEK--AAGSLEETY 202
             ..|...|...|.::|:.|||    :|..|     |..|:..|......:.|.:  ||.::....
  Fly   124 VKFGAEAYEIKVSENYVLLED----LRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDL 184

  Fly   203 YGEHTREWYTGFLLLAE--NVATDAVKQIYPNS--KYETVAT-----NFLQPPLFDDLINLVSTR 258
            .|.:..::..||....|  |...|...:|..|:  :|:..|.     ..:...|||...::...:
  Fly   185 KGPYEEKYTNGFFKSKEIMNFFCDRSAKILLNNIDQYDGHAAYIKDLQSVSEKLFDIYNDIKEPK 249

  Fly   259 S-KLSVFGHGDCWTPNFLTKYNERGQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYD 322
            | :.:...|||.|:.|.:.:||::.:......:|.||.:..|:|.||.:|:.|.||.:::.:.:|
  Fly   250 SDEFNALNHGDGWSNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFD 314

  Fly   323 ELLRAYLESAQDLIQDLG--GNAESIISWESLQEELKNFGRFGCGMGIESLPMTMMEDDEVADLD 385
            ..:..|   ..:|::.|.  ..::.:.:..|::..|..:..:.....|..:.:.:::..:.||.|
  Fly   315 YFVWFY---HSELVKHLKLLNYSKKLPTLRSIRNALNKYSGWAFICSISVMGVVLLDPTDDADFD 376

  Fly   386 GIKEN 390
            .|..|
  Fly   377 KIISN 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 67/315 (21%)
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 68/318 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.