DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG10553

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_651383.1 Gene:CG10553 / 43064 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster


Alignment Length:415 Identity:90/415 - (21%)
Similarity:161/415 - (38%) Gaps:82/415 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TFPSFADISAKFSEATLDEIIRNAGGTRHTSYKFGPSGKKGDAYLSRVFRITIYGVKEAEEGQDE 67
            |.|.:  :.....|..|..|:::...|:......|.:.  |:.|.:.:.||.:...||     |.
  Fly    16 TIPDW--VKPTVFEELLKRIVKDYKATKSMRANAGVAA--GENYATVMLRIELDVEKE-----DN 71

  Fly    68 KQLEISVIVKAMPDNLHRRRLFRSVIFFRNEINFYTKVLPAIEAFQKSRQPAPKKPFVEYPRCLA 132
            .|...:.::|....:...|::......|..|...|.:|:|.:|  |..|....:..|.      |
  Fly    72 TQTTKAFMLKTPHQSEQYRKVIEKTDIFDVERGMYVEVVPELE--QLYRDVGLEVKFG------A 128

  Fly   133 SLCD--GVNDFIALEDVGPRGYRAPVRQDYISLEDALLTMRTLGRFHGVALAFNALDSKNFEK-- 193
            .|.|  ..:.::.|||:.|||:                  ..:.|..|:..|......|.|.:  
  Fly   129 ELYDIEASDYYVLLEDLRPRGF------------------GNIDRLEGMDQAHTECVLKKFAQWH 175

  Fly   194 AAGSLEETYYGEHTREWYTGFLLLAENVATDA-----VKQIYPN----SKYETVATNF------- 242
            ||.::.....|.:..::..|||...|.|  ||     :|....|    ..|||...:.       
  Fly   176 AASAVRVETKGPYQEKYTKGFLRNEEIV--DAFINRSIKVFLDNVHLCKGYETYLNDLRIVSGKT 238

  Fly   243 ------LQPPLFDDLINLVSTRSKLSVFGHGDCWTPNFLTKYNERGQSEEIIIIDFQLARCSSLA 301
                  |..|..|:.|.|          .|||.|..|.:::||.:|:.::...:|.|:.:..|:.
  Fly   239 FEIVESLNNPSPDEFIAL----------NHGDGWANNIMSQYNTKGEIQDTYFVDLQVPKWGSVT 293

  Fly   302 LDLSFFIYSCTSQELREQHYDELLRAYLESAQDLIQDLG--GNAESIISWESLQEELKNFG--RF 362
            .||.:|:.|.||.:::...:|..:..|   ..:|::.|.  |.::::.:...:.:.|..:.  .|
  Fly   294 QDLYYFLLSSTSLDIKTSKFDYFIWFY---HSELVKHLKLLGYSKTLPTLRRINDALNKYSGWSF 355

  Fly   363 GCGMGIESLPMTMMEDDEVADLDGI 387
            .|...|  |...:::..:.||.|.:
  Fly   356 ICTATI--LAYVLLDPVDGADFDKV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 73/323 (23%)
CG10553NP_651383.1 EcKinase 52..333 CDD:281023 74/326 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.