DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG10559

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster


Alignment Length:391 Identity:88/391 - (22%)
Similarity:163/391 - (41%) Gaps:45/391 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DEIIRNAGGTRHTSYK-FGPSG--KKGDAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMPD 81
            :|::....|..:...| |.|..  |.|:.|.:.:.|:     |...|.||.....:|.::|...|
  Fly    20 EELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRL-----KLEVELQDHTIENVSYMLKTPYD 79

  Fly    82 NLHRRRLFRSVIFFRNEINFYTKVLPAIEAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALED 146
            ....|.:.|....|..|.:.:.:|:|.:|...|......|.....|.      .|..:|::.|:|
  Fly    80 FEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKAYE------IDAPDDYVLLQD 138

  Fly   147 VGPRGYRAPVRQDYISLEDALLTMRTLGRFHGVALAFNALDSKNFEKAAGSLEETY----YGEHT 207
            :||.|:|...|.:.:.:......::.:.::|.|:.....|        .|...:.|    |.:..
  Fly   139 LGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHL--------KGPYPQNYLQPTYADTM 195

  Fly   208 REWYTGFLLLAENVATDAVK--QIYPNSKYETVATNFLQPPLFDDLINLVST--RSKLSVFGHGD 268
            :|   ....:||.:....:|  .:|...:..:.|.:.:||.:. ||:..::|  ....:...|||
  Fly   196 KE---SIEQVAETLGKYFLKCLPLYEGYEEYSAAVHKMQPKIV-DLMYAMNTPDPQDFNALNHGD 256

  Fly   269 CWTPNFLTKY-NERGQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLESA 332
            |||.|.:.|| :|..:..|...:|.||.:.:|:|.||.:|:...|..|::...:|..::.|.:..
  Fly   257 CWTSNIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDHL 321

  Fly   333 QDLIQDLGGNAESIISWESLQEELKNFGRFGCGMGIESLPMTMMEDDEVADL----------DGI 387
            .:.::.|........:...|..:|..:||.|..:.....|..:::..|.|:|          ||:
  Fly   322 VEHLRMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPPVLLDRTEDANLTDFVTETDNGDGL 386

  Fly   388 K 388
            |
  Fly   387 K 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 69/306 (23%)
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 70/307 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
33.010

Return to query results.
Submit another query.